PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000822986
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 232aa    MW: 25192.1 Da    PI: 6.6468
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000822986genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.83.4e-42761751100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++kll++lpe++r da+ss+vyeA+ar+r+P+yG++g i++lq+q+ +l+a+la+
  MDP0000822986  76 PCAACKILRRRCAEKCVLAPYFPPNEPLKFTIAHRIFGASNIIKLLQELPESHRADAVSSMVYEANARIRNPIYGCAGAIFQLQKQIGELQAQLAK 171
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  MDP0000822986 172 AQAE 175
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.03975176IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-4176173IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MEFNAKTTTT MSXPPFSYSP SSSPSSPITS SFPXPNSHHL SNLSSPHAAN NDISTNPLPT  60
SLSPPPPPPP PVVLSPCAAC KILRRRCAEK CVLAPYFPPN EPLKFTIAHR IFGASNIIKL  120
LQELPESHRA DAVSSMVYEA NARIRNPIYG CAGAIFQLQK QIGELQAQLA KAQAELANLQ  180
CQQGNMIALI CMDMTQSKEE AISQQQQSNY IDTSCFLDEN NSGTAWDPLW T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376313.11e-168PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5X5X51e-104M5X5X5_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s04350.17e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-59LOB domain-containing protein 1